PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB09G16940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bHLH
Protein Properties Length: 485aa    MW: 51070.7 Da    PI: 6.4404
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB09G16940.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH34.53.6e-11264312555
                   HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
           HLH   5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                   h+++Er RR+ri +++  L+el+P+a  ++    +Ka++L + ++Y+k Lq
  OB09G16940.1 264 HSIAERLRRERIAERMKALQELVPNA--NKWLQTDKASMLDEIIDYVKFLQ 312
                   99***********************7..48888*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.57E-16257322IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000839.36E-13257316No hitNo description
PROSITE profilePS5088816.399259311IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.0E-15261321IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.8E-8264312IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003539.3E-12265317IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MQPTTREMQA MAAAAQISSL EELRNGHAGA AANAAGGVHD DFFDQMLSSL PPSAWPDLAA  60
AAKAAEDDAE GMHQQQQQQF GGPYDESAML ASRLRQHQIS GGGGGGGGGG GRGAAVKQMV  120
LQQLADLRQG HHMMLQGLGR SPAGAGAGDG LLLPLTLGNG GSGGDVQALL KAAAANSAGG  180
GDAGVYGGFA GSLQQQQHQH FQPHHPQQQA APTMPTQSFG GGGGGTAQPQ AXXXXXXXXX  240
XXGGAPAPPR QRVRARRGQA TDPHSIAERL RRERIAERMK ALQELVPNAN KWLQTDKASM  300
LDEIIDYVKF LQLQVKVLSM SRLGGAAAVA PLVADMSSEG RGGAANGGAP AAGGSDSLTV  360
TEQQVAKLME EDMGXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  420
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXGGGAD AEGSQPKDAA  480
SVSKP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1268273RLRRER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0057841e-114AP005784.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0014G10.
GenBankAP0149651e-114AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015696340.11e-163PREDICTED: transcription factor UNE12-like, partial
TrEMBLJ3MXG50.0J3MXG5_ORYBR; Uncharacterized protein
STRINGOB09G16940.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141937118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24260.11e-25LJRHL1-like 1